PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P25030_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TCP
Protein Properties Length: 287aa    MW: 30662.2 Da    PI: 7.8771
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P25030_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP119.53.9e-3769140273
                    TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                            a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+ +i+++tgt++ ++s+ 
  GSMUA_Achr5P25030_001  69 APKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAESSIIAATGTGTVPSSAL 140
                            789*************************************************************99999665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.9E-3074141IPR005333Transcription factor, TCP
PROSITE profilePS5136927.65975129IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MDRRDSSKQP QEAPRFHQAL GLRQAEKGEA TTASAAAESR DLLPSTVSVK ERWSQVVAAE  60
EDEQRRQLAP KRSSNKDRHT KVEGRGRRIR MPALCAARIF QLTRELGHKS DGETIQWLLQ  120
QAESSIIAAT GTGTVPSSAL ASAAARPNWP MLAAANFGPP LPGLLLPPGV LDSGFMASSS  180
SFGTGNGPMG SFLQRVGMHG MDLPGADVGA MSFVSMLAPH GQQSPGLELG LSQDGHGGEF  240
HPQATYQLFP QIGRARGGAG SSEGGQLRHH QQQQQQQAFP TQDDSQE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009402170.11e-169PREDICTED: transcription factor TCP20-like
SwissprotQ9LSD57e-55TCP20_ARATH; Transcription factor TCP20
TrEMBLM0T1H80.0M0T1H8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P25030_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.12e-52TCP family protein